PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp_un0602_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family NAC
Protein Properties Length: 308aa    MW: 34402.4 Da    PI: 7.0441
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp_un0602_001genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.4e-51141391128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrF Ptdeel+v+yL++k++g +++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +
  Tp_un0602_001  14 LPPGFRFYPTDEELMVQYLCRKAAGYHFSL-QLIAEIDLYKFDPWVLPNKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT-E 107
                    79**************************99.89***************8777899***********************************9999.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Tp_un0602_001 108 GKRVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                    999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-669162IPR003441NAC domain
PROSITE profilePS5100559.53114162IPR003441NAC domain
PfamPF023651.3E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGIQETDPLA QLSLPPGFRF YPTDEELMVQ YLCRKAAGYH FSLQLIAEID LYKFDPWVLP  60
NKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGKR VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLI EPSRRNGSSK LDDWVLCRIY KKQSSAQKQV FENVITSTRE  180
LSNNGTSSTT SSSSHFDDVL DSIGDRNFQF SNSNRVSSLG PALTGEKTGF NGLGDMSSFD  240
WGGFVSNVDH NSSQELGLSH VVPNVEFNCG YLKTEEEFNN SNELAQNGYG VDSVGFGYSG  300
QVGGFGFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-12111687174NAC domain-containing protein 19
3swm_B1e-12111687174NAC domain-containing protein 19
3swm_C1e-12111687174NAC domain-containing protein 19
3swm_D1e-12111687174NAC domain-containing protein 19
3swp_A1e-12111687174NAC domain-containing protein 19
3swp_B1e-12111687174NAC domain-containing protein 19
3swp_C1e-12111687174NAC domain-containing protein 19
3swp_D1e-12111687174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00012PBMTransfer from AT1G52890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667470.0KC966747.1 Brassica napus NAC transcription factor 19 (NAC19.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392855.10.0hypothetical protein EUTSA_v10011676mg
SwissprotQ9C9320.0NAC19_ARATH; NAC domain-containing protein 19
TrEMBLV4MFR50.0V4MFR5_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__4367__AT1G52890.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.10.0NAC domain containing protein 19